Lineage for d3so8a_ (3so8 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445942Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1445943Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1446071Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1446072Protein automated matches [191267] (3 species)
    not a true protein
  7. 1446078Species Human (Homo sapiens) [TaxId:9606] [189837] (14 PDB entries)
  8. 1446097Domain d3so8a_: 3so8 A: [233574]
    automated match to d1bd8a_

Details for d3so8a_

PDB Entry: 3so8 (more details), 1.9 Å

PDB Description: crystal structure of ankra
PDB Compounds: (A:) Ankyrin repeat family A protein 2

SCOPe Domain Sequences for d3so8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so8a_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslsvhqlaaqgemlylatrieqenvinhtdeegftplmwaaahgqiavvefllqngadp
qllgkgresalslacskgytdivkmlldcgvdvneydwnggtpllyavhgnhvkcvkmll
esgadptietdsgynsmdlavalgyrsvqqvieshllkllqn

SCOPe Domain Coordinates for d3so8a_:

Click to download the PDB-style file with coordinates for d3so8a_.
(The format of our PDB-style files is described here.)

Timeline for d3so8a_: