Lineage for d3snpa1 (3snp A:2-623)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141742Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2141743Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) (S)
  5. 2141744Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 protein domains)
    duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry
  6. 2141772Protein automated matches [233562] (1 species)
    not a true protein
  7. 2141773Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [233571] (3 PDB entries)
  8. 2141776Domain d3snpa1: 3snp A:2-623 [233572]
    Other proteins in same PDB: d3snpa2, d3snpb2
    automated match to d2b3xa2
    protein/RNA complex

Details for d3snpa1

PDB Entry: 3snp (more details), 2.8 Å

PDB Description: crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire rna
PDB Compounds: (A:) Cytoplasmic aconitate hydratase

SCOPe Domain Sequences for d3snpa1:

Sequence, based on SEQRES records: (download)

>d3snpa1 c.83.1.1 (A:2-623) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
lvidhsiqvdfnrradslqknqdlefernrerfeflkwgskafrnmriippgsgiihqvn
leylarvvfdqdgyyypdslvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpq
vigyrlmgkphplvtstdivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcp
eygatatffpvdevsikylvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvvel
dlktvvpccsgpkrpqdkvavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndse
ftlshgsvviaaitsstntsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyy
lresgvmpylsqlgfdvvgygsmtcignsgplpepvveaitqgdlvavgvlsgnrnfegr
vhpntranylaspplviayaiagtiridfekeplgtnakgqqvflrdiwptreeiqaver
qyvipgmftevyqkietvnasw

Sequence, based on observed residues (ATOM records): (download)

>d3snpa1 c.83.1.1 (A:2-623) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
snpfaylaepldpaqpgkkffnlnkldysrygrlpfsirvlleaavrncdkflvkkedie
nilnwnvtqhmnievpfkparvilqdftgvpsvvdfaamrdavkklggdpekinpicpvd
lvidhsefernrerfeflkwgskafrnmriippgsgiihqvnleylarvvfdqdgyyypd
slvgtdshttmidglgvlgwgvggieaeavmlgqpismvlpqvigyrlmgkphplvtstd
ivltitkhlrqvgvvgkfveffgpgvaqlsiadratianmcpeygatatffpvdevsiky
lvqtgrdeskvkqirkylqavgmfrdysdpsqdpdftqvveldlktvvpccsgpkrpqdk
vavsdmkkdfesclgakqgfkgfqvapdhhndhktfiyndseftlshgsvviaaitsstn
tsnpsvmlgagllakkavdaglnvkpyvktslspgsgvvtyylresgvmpylsqlgfdvv
plpepvveaitqgdlvavgvlsgnrnfegrvhpntranylaspplviayaiagtiridfe
keplgtnakgqqvflrdiwptreeiqaverqyvipgmftevyqkietvnasw

SCOPe Domain Coordinates for d3snpa1:

Click to download the PDB-style file with coordinates for d3snpa1.
(The format of our PDB-style files is described here.)

Timeline for d3snpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3snpa2