SCOPe 2.05: Domain d3snla_: 3snl A:

Lineage for d3snla_ (3snl A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d3snla_: 3snl A: [233569]
   automated match to d3wi2a_
   complexed with 548, mg, zn

Details for d3snla_

PDB Entry: 3snl, 2.4 Å

PDB Description: highly potent, selective, and orally active phosphodiestarase 10a inhibitors

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3snla_:

Sequence; same for both SEQRES and ATOM records:

>d3snla_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirge

Timeline for d3snla_:

• d3snla_ first appeared in SCOPe 2.03
  
• d3snla_ appears in SCOPe 2.04
  
• d3snla_ is called d3snla1 in SCOPe 2.06
  
• d3snla_ appears in the current release, SCOPe 2.08, called d3snla1