Lineage for d3snib1 (3sni B:439-759)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2015250Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2015251Protein automated matches [190983] (9 species)
    not a true protein
  7. 2015252Species Human (Homo sapiens) [TaxId:9606] [188676] (111 PDB entries)
  8. 2015331Domain d3snib1: 3sni B:439-759 [233567]
    Other proteins in same PDB: d3snia2, d3snib2
    automated match to d3wi2a_
    complexed with 546, cl, mg, zn

Details for d3snib1

PDB Entry: 3sni (more details), 1.9 Å

PDB Description: highly potent, selective, and orally active phosphodiestarase 10a inhibitors
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3snib1:

Sequence, based on SEQRES records: (download)

>d3snib1 a.211.1.0 (B:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

Sequence, based on observed residues (ATOM records): (download)

>d3snib1 a.211.1.0 (B:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsytstmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfgn
rkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaegd
emkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnlsq
wekvirge

SCOPe Domain Coordinates for d3snib1:

Click to download the PDB-style file with coordinates for d3snib1.
(The format of our PDB-style files is described here.)

Timeline for d3snib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3snib2