Lineage for d3sn7a1 (3sn7 A:439-759)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2737183Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2737184Protein automated matches [190983] (12 species)
    not a true protein
  7. 2737203Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)
  8. 2737338Domain d3sn7a1: 3sn7 A:439-759 [233566]
    Other proteins in same PDB: d3sn7a2, d3sn7b2
    automated match to d3wi2a_
    complexed with 540, cl, mg, zn

Details for d3sn7a1

PDB Entry: 3sn7 (more details), 1.82 Å

PDB Description: highly potent, selective, and orally active phosphodiestarase 10a inhibitors
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d3sn7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sn7a1 a.211.1.0 (A:439-759) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

SCOPe Domain Coordinates for d3sn7a1:

Click to download the PDB-style file with coordinates for d3sn7a1.
(The format of our PDB-style files is described here.)

Timeline for d3sn7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sn7a2