Lineage for d3sn5b_ (3sn5 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278021Species Human (Homo sapiens) [TaxId:9606] [196470] (23 PDB entries)
  8. 1278082Domain d3sn5b_: 3sn5 B: [233564]
    automated match to d3b98a_
    complexed with hem, k2b, unx

Details for d3sn5b_

PDB Entry: 3sn5 (more details), 2.75 Å

PDB Description: Crystal structure of human CYP7A1 in complex with cholest-4-en-3-one
PDB Compounds: (B:) Cholesterol 7-alpha-monooxygenase

SCOPe Domain Sequences for d3sn5b_:

Sequence, based on SEQRES records: (download)

>d3sn5b_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahiln
nldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmfln
dtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagq
kvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkd
diialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgatic
pgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfkh

Sequence, based on observed residues (ATOM records): (download)

>d3sn5b_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimrawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnfkqfdk
vfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlstfddle
kakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslegnpic
lsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypqlm
hldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaihei
kqflilmlsyfeleliakcppldqsraglgilpplndiefkykfkh

SCOPe Domain Coordinates for d3sn5b_:

Click to download the PDB-style file with coordinates for d3sn5b_.
(The format of our PDB-style files is described here.)

Timeline for d3sn5b_: