Lineage for d3sn5a1 (3sn5 A:25-503)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005573Species Human (Homo sapiens) [TaxId:9606] [196470] (36 PDB entries)
  8. 2005643Domain d3sn5a1: 3sn5 A:25-503 [233563]
    Other proteins in same PDB: d3sn5a2
    automated match to d3b98a_
    complexed with hem, k2b, unx

Details for d3sn5a1

PDB Entry: 3sn5 (more details), 2.75 Å

PDB Description: Crystal structure of human CYP7A1 in complex with cholest-4-en-3-one
PDB Compounds: (A:) Cholesterol 7-alpha-monooxygenase

SCOPe Domain Sequences for d3sn5a1:

Sequence, based on SEQRES records: (download)

>d3sn5a1 a.104.1.0 (A:25-503) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahiln
nldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmfln
dtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagq
kvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkd
diialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgatic
pgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfkh

Sequence, based on observed residues (ATOM records): (download)

>d3sn5a1 a.104.1.0 (A:25-503) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpls
yhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnsltes
mmenlqrimrtaawvtegmysfcyrvmfeagyltifgrdltqkahilnnldnfkqfdkvf
palvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlstfddleka
kthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslegnpicls
qaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypqlmhl
dpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaiheikq
flilmlsyfeleliegqakcppldqsraglgilpplndiefkykfkh

SCOPe Domain Coordinates for d3sn5a1:

Click to download the PDB-style file with coordinates for d3sn5a1.
(The format of our PDB-style files is described here.)

Timeline for d3sn5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sn5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3sn5b_