SCOPe 2.06: Domain d3smsa1: 3sms A:11-156

Lineage for d3smsa1 (3sms A:11-156)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (4 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein Pantothenate kinase 3, PANK3 [159624] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159625] (3 PDB entries)
   Uniprot Q9H999 12-152! Uniprot Q9H999 157-368

8. Domain d3smsa1: 3sms A:11-156 [233561]
   automated match to d2i7na1
   complexed with adp, rnh, unx

Details for d3smsa1

PDB Entry: 3sms, 2.2 Å

PDB Description: Human Pantothenate kinase 3 in complex with a pantothenate analog

PDB Compounds: (A:) Pantothenate kinase 3

SCOPe Domain Sequences for d3smsa1:

Sequence, based on SEQRES records:

>d3smsa1 c.55.1.14 (A:11-156) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
fpwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlel
kdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtign
lhlhkldeldclvkgllyidsvsfng

Sequence, based on observed residues (ATOM records):

>d3smsa1 c.55.1.14 (A:11-156) Pantothenate kinase 3, PANK3 {Human (Homo sapiens) [TaxId: 9606]}
fpwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlel
kdltlfgrrgnlhfirfptqdlptfiqmgrdtvlcatgggaykfekdfrtignlhlhkld
eldclvkgllyidsvsfng

Timeline for d3smsa1:

• d3smsa1 first appeared in SCOPe 2.03
  
• d3smsa1 appears in SCOPe 2.05
  
• d3smsa1 appears in SCOPe 2.07
  
• d3smsa1 appears in the current release, SCOPe 2.08