Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries) Uniprot Q08499 388-713 |
Domain d3sl8c_: 3sl8 C: [233557] automated match to d2fm0a_ complexed with dms, edo, jn7, peg, po4, zn |
PDB Entry: 3sl8 (more details), 2.6 Å
SCOPe Domain Sequences for d3sl8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sl8c_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa dlvhpdaqdildtlednrewyqst
Timeline for d3sl8c_: