SCOPe 2.08: Domain d3sl7a1: 3sl7 A:76-232

Lineage for d3sl7a1 (3sl7 A:76-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries)

8. Domain d3sl7a1: 3sl7 A:76-232 [233554]
   Other proteins in same PDB: d3sl7a2, d3sl7a3, d3sl7b2, d3sl7b3
   automated match to d4gqya_
   complexed with act, gol

Details for d3sl7a1

PDB Entry: 3sl7, 1.91 Å

PDB Description: Crystal structure of CBS-pair protein, CBSX2 from Arabidopsis thaliana

PDB Compounds: (A:) CBS domain-containing protein CBSX2

SCOPe Domain Sequences for d3sl7a1:

Sequence, based on SEQRES records:

>d3sl7a1 d.37.1.0 (A:76-232) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllald
sisgrsqndtnlfpdvdstwktfnelqklisktygkvvgdlmtpsplvvrdstnledaar
llletkfrrlpvvdadgkligiltrgnvvraalqikr

Sequence, based on observed residues (ATOM records):

>d3sl7a1 d.37.1.0 (A:76-232) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gytvgdfmtprqnlhvvkpstsvddalellvekkvtglpviddnwtlvgvvsdydllalt
wktfnelqklisktygkvvgdlmtpsplvvrdstnledaarllletkfrrlpvvdadgkl
igiltrgnvvraalqikr

Timeline for d3sl7a1:

• d3sl7a1 first appeared in SCOPe 2.03, called d3sl7a_
  
• d3sl7a1 appears in SCOPe 2.07