SCOPe 2.05: Domain d3sl5d_: 3sl5 D:

Lineage for d3sl5d_ (3sl5 D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3sl5d_: 3sl5 D: [233550]
   automated match to d3sl5a_
   complexed with dms, edo, epe, j25, zn

Details for d3sl5d_

PDB Entry: 3sl5, 2.65 Å

PDB Description: crystal structure of the catalytic domain of pde4d2 complexed with compound 10d

PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3sl5d_:

Sequence; same for both SEQRES and ATOM records:

>d3sl5d_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
vlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplq
lyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadl
vhpdaqdildtlednrewyqstip

Timeline for d3sl5d_:

• d3sl5d_ first appeared in SCOPe 2.03
  
• d3sl5d_ appears in SCOPe 2.04
  
• d3sl5d_ appears in SCOPe 2.06
  
• d3sl5d_ appears in the current release, SCOPe 2.08