Class a: All alpha proteins [46456] (284 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (32 PDB entries) Uniprot Q08499 388-713 |
Domain d3sl3c_: 3sl3 C: [233542] Other proteins in same PDB: d3sl3a_ automated match to d2fm0a_ complexed with dms, edo, epe, peg, po4, zn |
PDB Entry: 3sl3 (more details), 2.1 Å
SCOPe Domain Sequences for d3sl3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sl3c_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad lvhpdaqdildtlednrewyqsti
Timeline for d3sl3c_: