Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) |
Protein Murine polyomavirus coat protein vp1 [49657] (1 species) |
Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries) |
Domain d1sidd_: 1sid D: [23354] |
PDB Entry: 1sid (more details), 3.65 Å
SCOP Domain Sequences for d1sidd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sidd_ b.10.1.4 (D:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16} kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk npypmaslisslfnnmlpqvqgqpmegentqveevrvydg
Timeline for d1sidd_: