SCOPe 2.04: Domain d3sjnb1: 3sjn B:1-128

Lineage for d3sjnb1 (3sjn B:1-128)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Shewanella pealeana [TaxId:398579] [233536] (1 PDB entry)

8. Domain d3sjnb1: 3sjn B:1-128 [233537]
   Other proteins in same PDB: d3sjna2, d3sjnb2
   automated match to d2poza1
   complexed with gol, mg, unl

Details for d3sjnb1

PDB Entry: 3sjn, 1.9 Å

PDB Description: Crystal structure of enolase Spea_3858 (target EFI-500646) from Shewanella pealeana with magnesium bound

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3sjnb1:

Sequence; same for both SEQRES and ATOM records:

>d3sjnb1 d.54.1.0 (B:1-128) automated matches {Shewanella pealeana [TaxId: 398579]}
vlkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqt
nfycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygv
pvhtllgg

Timeline for d3sjnb1:

• d3sjnb1 first appeared in SCOPe 2.03
  
• d3sjnb1 appears in SCOPe 2.05
  
• d3sjnb1 appears in the current release, SCOPe 2.08