Lineage for d3sjnb1 (3sjn B:2-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948562Species Shewanella pealeana [TaxId:398579] [233536] (1 PDB entry)
  8. 2948564Domain d3sjnb1: 3sjn B:2-128 [233537]
    Other proteins in same PDB: d3sjna2, d3sjna3, d3sjnb2, d3sjnb3
    automated match to d2poza1
    complexed with gol, mg, unl

Details for d3sjnb1

PDB Entry: 3sjn (more details), 1.9 Å

PDB Description: Crystal structure of enolase Spea_3858 (target EFI-500646) from Shewanella pealeana with magnesium bound
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3sjnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjnb1 d.54.1.0 (B:2-128) automated matches {Shewanella pealeana [TaxId: 398579]}
lkitdievlhlrvpamdadcewgedavivkvhtdkgivgvgeadssplvvqacieapqtn
fycnglkrlligenaleierlwnkmywgsnymgrrgagihaisaidialwdiagqfygvp
vhtllgg

SCOPe Domain Coordinates for d3sjnb1:

Click to download the PDB-style file with coordinates for d3sjnb1.
(The format of our PDB-style files is described here.)

Timeline for d3sjnb1: