Lineage for d1sidc_ (1sid C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1813264Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1813265Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 1813269Protein Polyomavirus coat proteins [49657] (2 species)
  7. 1813270Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)
  8. 1813318Domain d1sidc_: 1sid C: [23353]

Details for d1sidc_

PDB Entry: 1sid (more details), 3.65 Å

PDB Description: murine polyomavirus complexed with 3'sialyl lactose
PDB Compounds: (C:) polyomavirus coat protein vp1

SCOPe Domain Sequences for d1sidc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sidc_ b.121.6.1 (C:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
kacprpapvpkllikggmevldlvtgpdsvteieaflnprmgqpptpeslteggqyygws
rginlatsdtedspgnntlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgsll
dvhgfnkptdtvntkgistpvegsqyhvfavggepldlqglvtdartkykeegvvtikti
tkkdmvnkdqvlnpiskakldkdgmypveiwhpdpaknentryfgnytggtttppvlqft
ntlttvlldengvgplckgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
npypmaslisslfnnmlpqvqgqpmegentqveevrvydgtepvpgdpdmtryvdrf

SCOPe Domain Coordinates for d1sidc_:

Click to download the PDB-style file with coordinates for d1sidc_.
(The format of our PDB-style files is described here.)

Timeline for d1sidc_: