Lineage for d3scxa2 (3scx A:376-903)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1451900Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1451992Protein Family B DNA polymerase [56680] (7 species)
  7. 1451993Species Bacteriophage RB69 [TaxId:12353] [56681] (49 PDB entries)
  8. 1452021Domain d3scxa2: 3scx A:376-903 [233529]
    Other proteins in same PDB: d3scxa1
    automated match to d1ih7a2
    protein/DNA complex; complexed with ca, dup; mutant

Details for d3scxa2

PDB Entry: 3scx (more details), 2.35 Å

PDB Description: RB69 DNA Polymerase Triple Mutant(L561A/S565G/Y567A) Ternary Complex with dUpNpp and a Deoxy-terminated Primer in the Presence of Ca2+
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3scxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scxa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfaf

SCOPe Domain Coordinates for d3scxa2:

Click to download the PDB-style file with coordinates for d3scxa2.
(The format of our PDB-style files is described here.)

Timeline for d3scxa2: