| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein automated matches [190888] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries) |
| Domain d3s9db2: 3s9d B:110-204 [233525] Other proteins in same PDB: d3s9da_, d3s9dc_ automated match to d2hyma2 complexed with cl |
PDB Entry: 3s9d (more details), 2 Å
SCOPe Domain Sequences for d3s9db2:
Sequence, based on SEQRES records: (download)
>d3s9db2 b.1.2.1 (B:110-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllp
>d3s9db2 b.1.2.1 (B:110-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpselqfdlslvieeqsegivkkhkpemsgnftyiidklipnt
nycvsvylehqaviksplkctllp
Timeline for d3s9db2:
View in 3DDomains from other chains: (mouse over for more information) d3s9da_, d3s9dc_, d3s9dd1, d3s9dd2 |