Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein automated matches [190888] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188282] (16 PDB entries) |
Domain d3s9dd1: 3s9d D:11-109 [233522] Other proteins in same PDB: d3s9da_, d3s9dc_ automated match to d2hyma1 complexed with cl |
PDB Entry: 3s9d (more details), 2 Å
SCOPe Domain Sequences for d3s9dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s9dd1 b.1.2.1 (D:11-109) automated matches {Human (Homo sapiens) [TaxId: 9606]} sctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncanttrsfcdltd ewrstheayvtvlegfsgnttlfscshnfwlaidmsfep
Timeline for d3s9dd1:
View in 3D Domains from other chains: (mouse over for more information) d3s9da_, d3s9db1, d3s9db2, d3s9dc_ |