SCOPe 2.06: Domain d3s90b2: 3s90 B:129-252

Lineage for d3s90b2 (3s90 B:129-252)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (15 PDB entries)
   Uniprot P18206 1-257

8. Domain d3s90b2: 3s90 B:129-252 [233518]
   automated match to d1rkea2

Details for d3s90b2

PDB Entry: 3s90, 1.97 Å

PDB Description: human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)

PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d3s90b2:

Sequence; same for both SEQRES and ATOM records:

>d3s90b2 a.24.9.1 (B:129-252) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qlts

Timeline for d3s90b2:

• d3s90b2 first appeared in SCOPe 2.03
  
• d3s90b2 appears in SCOPe 2.05
  
• d3s90b2 appears in SCOPe 2.07
  
• d3s90b2 appears in the current release, SCOPe 2.08