Lineage for d3s90b1 (3s90 B:2-128)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700113Protein Vinculin [47224] (2 species)
  7. 2700127Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2700136Domain d3s90b1: 3s90 B:2-128 [233517]
    automated match to d1syqa1

Details for d3s90b1

PDB Entry: 3s90 (more details), 1.97 Å

PDB Description: human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)
PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d3s90b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s90b1 a.24.9.1 (B:2-128) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
pvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgket
vqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsd
llltfde

SCOPe Domain Coordinates for d3s90b1:

Click to download the PDB-style file with coordinates for d3s90b1.
(The format of our PDB-style files is described here.)

Timeline for d3s90b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s90b2