SCOPe 2.07: Domain d3s90a2: 3s90 A:129-250

Lineage for d3s90a2 (3s90 A:129-250)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 protein domains)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
   Uniprot P18206 1-257

8. Domain d3s90a2: 3s90 A:129-250 [233516]
   automated match to d1rkea2

Details for d3s90a2

PDB Entry: 3s90, 1.97 Å

PDB Description: human vinculin head domain vh1 (residues 1-252) in complex with murine talin (vbs33; residues 1512-1546)

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d3s90a2:

Sequence; same for both SEQRES and ATOM records:

>d3s90a2 a.24.9.1 (A:129-250) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
ql

Timeline for d3s90a2:

• d3s90a2 first appeared in SCOPe 2.03
  
• d3s90a2 appears in SCOPe 2.06