![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
![]() | Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
![]() | Protein automated matches [195426] (5 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries) |
![]() | Domain d3rtlb_: 3rtl B: [233502] automated match to d3sika_ complexed with cl, hem, mg |
PDB Entry: 3rtl (more details), 1.45 Å
SCOPe Domain Sequences for d3rtlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtlb_ b.1.28.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]} gskmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmve gqrvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftkan
Timeline for d3rtlb_: