SCOPe 2.05: Domain d3rtlb_: 3rtl B:

Lineage for d3rtlb_ (3rtl B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries)

8. Domain d3rtlb_: 3rtl B: [233502]
   automated match to d3sika_
   complexed with cl, hem, mg

Details for d3rtlb_

PDB Entry: 3rtl, 1.45 Å

PDB Description: staphylococcus aureus heme-bound isdb-n2

PDB Compounds: (B:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rtlb_:

Sequence; same for both SEQRES and ATOM records:

>d3rtlb_ b.1.28.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
gskmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmve
gqrvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdkeaftkan

Timeline for d3rtlb_:

• d3rtlb_ first appeared in SCOPe 2.03
  
• d3rtlb_ appears in SCOPe 2.04
  
• d3rtlb_ is called d3rtlb1 in SCOPe 2.06
  
• d3rtlb_ appears in the current release, SCOPe 2.08, called d3rtlb1