SCOPe 2.06: Domain d3rtla1: 3rtl A:341-452

Lineage for d3rtla1 (3rtl A:341-452)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (7 PDB entries)

8. Domain d3rtla1: 3rtl A:341-452 [233501]
   Other proteins in same PDB: d3rtla2, d3rtlb2, d3rtlc2, d3rtld2
   automated match to d3sika_
   complexed with cl, hem, mg

Details for d3rtla1

PDB Entry: 3rtl, 1.45 Å

PDB Description: staphylococcus aureus heme-bound isdb-n2

PDB Compounds: (A:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d3rtla1:

Sequence; same for both SEQRES and ATOM records:

>d3rtla1 b.1.28.0 (A:341-452) automated matches {Staphylococcus aureus [TaxId: 158879]}
kmtdlqdtkyvvyesvennesmmdtfvkhpiktgmlngkkymvmettnddywkdfmvegq
rvrtiskdaknntrtiifpyvegktlydaivkvhvktidydgqyhvrivdke

Timeline for d3rtla1:

• d3rtla1 first appeared in SCOPe 2.03, called d3rtla_
  
• d3rtla1 was called d3rtla_ in SCOPe 2.05
  
• d3rtla1 appears in SCOPe 2.07
  
• d3rtla1 appears in the current release, SCOPe 2.08