Lineage for d3rt3b1 (3rt3 B:3-78)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932539Domain d3rt3b1: 3rt3 B:3-78 [233498]
    Other proteins in same PDB: d3rt3c_
    automated match to d1z2ma1
    complexed with sin

Details for d3rt3b1

PDB Entry: 3rt3 (more details), 2.01 Å

PDB Description: complex of influenza virus protein with host anti-viral factor
PDB Compounds: (B:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d3rt3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rt3b1 d.15.1.1 (B:3-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wdltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplas
qglgpgstvllvvdks

SCOPe Domain Coordinates for d3rt3b1:

Click to download the PDB-style file with coordinates for d3rt3b1.
(The format of our PDB-style files is described here.)

Timeline for d3rt3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rt3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3rt3c_