SCOPe 2.08: Domain d3rrve1: 3rrv E:2-252

Lineage for d3rrve1 (3rrv E:2-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)

8. Domain d3rrve1: 3rrv E:2-252 [233494]
   Other proteins in same PDB: d3rrvb2, d3rrve2, d3rrvf2
   automated match to d2ej5a_
   complexed with ca, cl, edo

Details for d3rrve1

PDB Entry: 3rrv, 2.45 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis

PDB Compounds: (E:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3rrve1:

Sequence; same for both SEQRES and ATOM records:

>d3rrve1 c.14.1.0 (E:2-252) automated matches {Mycobacterium avium [TaxId: 1770]}
ydmpteidvradgalriitlnrpdslnsvnddlhvglarlwqrltddptaraavitgagr
afsaggdfgylkelsadadlraktirdgreivlgmarcripvvaavngpavglgcslval
sdivyiaenayladphvqvglvaadggpltwplhislllakeyaltgtrisaqravelgl
anhvaddpvaeaiacakkilelpqqavestkrvlnihleravlasldyalsaesqsfvte
dfrsivtklad

Timeline for d3rrve1:

• d3rrve1 first appeared in SCOPe 2.03, called d3rrve_
  
• d3rrve1 appears in SCOPe 2.07