Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries) |
Domain d3rrvc_: 3rrv C: [233493] Other proteins in same PDB: d3rrvb2, d3rrve2, d3rrvf2 automated match to d2ej5a_ complexed with ca, cl, edo |
PDB Entry: 3rrv (more details), 2.45 Å
SCOPe Domain Sequences for d3rrvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rrvc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 1770]} ydmpteidvradgalriitlnrpdslnsvnddlhvglarlwqrltddptaraavitgagr afsaggdfgylkelsadadlraktirdgreivlgmarcripvvaavngpavglgcslval sdivyiaenayladphvqvglvaadggpltwplhislllakeyaltgtrisaqravelgl anhvaddpvaeaiacakkilelpqqavestkrvlnihleravlasldyalsaesqsfvte dfrsivtkl
Timeline for d3rrvc_: