SCOPe 2.08: Domain d3rq7a2: 3rq7 A:508-594

Lineage for d3rq7a2 (3rq7 A:508-594)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (3 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)

8. Domain d3rq7a2: 3rq7 A:508-594 [233485]
   automated match to d4mlua2

Details for d3rq7a2

PDB Entry: 3rq7, 1.55 Å

PDB Description: Polo-like kinase 1 Polo box domain in complex with a C6H5(CH2)8-derivatized peptide inhibitor

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3rq7a2:

Sequence; same for both SEQRES and ATOM records:

>d3rq7a2 d.223.1.2 (A:508-594) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrlsll
eeygcckelasrlryartmvdkllssr

Timeline for d3rq7a2:

• d3rq7a2 first appeared in SCOPe 2.03
  
• d3rq7a2 appears in SCOPe 2.07