Lineage for d3rq7a2 (3rq7 A:508-594)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564215Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2564216Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2564228Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 2564229Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 2564230Species Human (Homo sapiens) [TaxId:9606] [102858] (28 PDB entries)
  8. 2564234Domain d3rq7a2: 3rq7 A:508-594 [233485]
    automated match to d4mlua2

Details for d3rq7a2

PDB Entry: 3rq7 (more details), 1.55 Å

PDB Description: Polo-like kinase 1 Polo box domain in complex with a C6H5(CH2)8-derivatized peptide inhibitor
PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d3rq7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rq7a2 d.223.1.2 (A:508-594) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lpylrtwfrtrsaiilhlsngsvqinffqdhtklilcplmaavtyidekrdfrtyrlsll
eeygcckelasrlryartmvdkllssr

SCOPe Domain Coordinates for d3rq7a2:

Click to download the PDB-style file with coordinates for d3rq7a2.
(The format of our PDB-style files is described here.)

Timeline for d3rq7a2: