SCOPe 2.04: Domain d3rota_: 3rot A:

Lineage for d3rota_ (3rot A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (49 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [233482] (1 PDB entry)

8. Domain d3rota_: 3rot A: [233483]
   automated match to d3ksma_
   complexed with gol

Details for d3rota_

PDB Entry: 3rot, 1.91 Å

PDB Description: Crystal structure of ABC sugar transporter (periplasmic sugar binding protein) from Legionella pneumophila

PDB Compounds: (A:) ABC sugar transporter, periplasmic sugar binding protein

SCOPe Domain Sequences for d3rota_:

Sequence; same for both SEQRES and ATOM records:

>d3rota_ c.93.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
rdkyylithgsqdpywtslfqgakkaaeelkvdlqilappgandvpkqvqfiesalatyp
sgiattipsdtafskslqranklnipviavdtrpkdktknpylvflgsdnllagkklgek
aleltpsakralvlnpqpghiglekraygiktilqdkgiffeeldvgtdpnqvqsrvksy
fkihpetniifcltsqaldplgqmllhpdrydfnyqpqvysfdktpntvslihkklvnyv
mdqqpflmgylsitqlvlmnryqlnpvnintam

Timeline for d3rota_:

• d3rota_ first appeared in SCOPe 2.03
  
• d3rota_ appears in SCOPe 2.05
  
• d3rota_ appears in the current release, SCOPe 2.08