Lineage for d3rota_ (3rot A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624872Species Legionella pneumophila [TaxId:272624] [233482] (1 PDB entry)
  8. 1624873Domain d3rota_: 3rot A: [233483]
    automated match to d3ksma_
    complexed with gol

Details for d3rota_

PDB Entry: 3rot (more details), 1.91 Å

PDB Description: Crystal structure of ABC sugar transporter (periplasmic sugar binding protein) from Legionella pneumophila
PDB Compounds: (A:) ABC sugar transporter, periplasmic sugar binding protein

SCOPe Domain Sequences for d3rota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rota_ c.93.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
rdkyylithgsqdpywtslfqgakkaaeelkvdlqilappgandvpkqvqfiesalatyp
sgiattipsdtafskslqranklnipviavdtrpkdktknpylvflgsdnllagkklgek
aleltpsakralvlnpqpghiglekraygiktilqdkgiffeeldvgtdpnqvqsrvksy
fkihpetniifcltsqaldplgqmllhpdrydfnyqpqvysfdktpntvslihkklvnyv
mdqqpflmgylsitqlvlmnryqlnpvnintam

SCOPe Domain Coordinates for d3rota_:

Click to download the PDB-style file with coordinates for d3rota_.
(The format of our PDB-style files is described here.)

Timeline for d3rota_: