Lineage for d3rn5b1 (3rn5 B:147-249)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791336Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2791368Family b.40.16.0: automated matches [233467] (1 protein)
    not a true family
  6. 2791369Protein automated matches [233468] (3 species)
    not a true protein
  7. 2791370Species Human (Homo sapiens) [TaxId:9606] [233469] (2 PDB entries)
  8. 2791377Domain d3rn5b1: 3rn5 B:147-249 [233476]
    automated match to d2oq0d2
    protein/DNA complex; complexed with edo

Details for d3rn5b1

PDB Entry: 3rn5 (more details), 2.5 Å

PDB Description: Structural basis of cytosolic DNA recognition by innate immune receptors
PDB Compounds: (B:) Interferon-inducible protein AIM2

SCOPe Domain Sequences for d3rn5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rn5b1 b.40.16.0 (B:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egfqkrclpvmvlkakkpftfetqegkqemfhatvatekefffvkvfntllkdkfipkri
iiiaryyrhsgflevnsasrvldaesdqkvnvplniirkaget

SCOPe Domain Coordinates for d3rn5b1:

Click to download the PDB-style file with coordinates for d3rn5b1.
(The format of our PDB-style files is described here.)

Timeline for d3rn5b1: