SCOPe 2.03: Domain d3rn2a2: 3rn2 A:250-340

Lineage for d3rn2a2 (3rn2 A:250-340)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family
6. Protein automated matches [233468] (2 species)
   not a true protein
7. Species Homo sapiens [TaxId:9606] [233469] (2 PDB entries)

8. Domain d3rn2a2: 3rn2 A:250-340 [233471]
   automated match to d2oq0a1

Details for d3rn2a2

PDB Entry: 3rn2, 2.55 Å

PDB Description: Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors

PDB Compounds: (A:) Interferon-inducible protein AIM2

SCOPe Domain Sequences for d3rn2a2:

Sequence; same for both SEQRES and ATOM records:

>d3rn2a2 b.40.16.0 (A:250-340) automated matches {Homo sapiens [TaxId: 9606]}
pkintlqtqplgtivnglfvvqkvtekkknilfdlsdntgkmevlgvrnedtmkckegdk
vrltfftlskngeklqltsgvhstikvikak

Timeline for d3rn2a2:

• d3rn2a2 is new in SCOPe 2.03-stable
  
• d3rn2a2 appears in SCOPe 2.04
  
• d3rn2a2 appears in the current release, SCOPe 2.08