Lineage for d1cn3b_ (1cn3 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2087547Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2087548Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2087552Protein Polyomavirus coat proteins [49657] (2 species)
  7. 2087553Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)
  8. 2087595Domain d1cn3b_: 1cn3 B: [23347]

Details for d1cn3b_

PDB Entry: 1cn3 (more details), 2.2 Å

PDB Description: interaction of polyomavirus internal protein vp2 with major capsid protein vp1 and implications for participation of vp2 in viral entry
PDB Compounds: (B:) coat protein vp1

SCOPe Domain Sequences for d1cn3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cn3b_ b.121.6.1 (B:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn
tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

SCOPe Domain Coordinates for d1cn3b_:

Click to download the PDB-style file with coordinates for d1cn3b_.
(The format of our PDB-style files is described here.)

Timeline for d1cn3b_: