Lineage for d3rn1f_ (3rn1 F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554711Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1554747Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 1554748Protein automated matches [232762] (1 species)
    not a true protein
  7. 1554749Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 1554763Domain d3rn1f_: 3rn1 F: [233466]
    Other proteins in same PDB: d3rn1c_, d3rn1e_
    automated match to d2madh_
    complexed with 1pe, act, ca, edo, hec, na, pg4

Details for d3rn1f_

PDB Entry: 3rn1 (more details), 1.93 Å

PDB Description: Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (F:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3rn1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rn1f_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3rn1f_:

Click to download the PDB-style file with coordinates for d3rn1f_.
(The format of our PDB-style files is described here.)

Timeline for d3rn1f_: