SCOPe 2.04: Domain d3rn1d_: 3rn1 D:

Lineage for d3rn1d_ (3rn1 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.0: automated matches [232760] (1 protein)
   not a true family

6. Protein automated matches [232762] (1 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)

8. Domain d3rn1d_: 3rn1 D: [233465]
   Other proteins in same PDB: d3rn1c_, d3rn1e_
   automated match to d2madh_
   complexed with 1pe, act, ca, edo, hec, na, pg4

Details for d3rn1d_

PDB Entry: 3rn1, 1.93 Å

PDB Description: Crystal Structure of the W199E-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (D:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3rn1d_:

Sequence; same for both SEQRES and ATOM records:

>d3rn1d_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

Timeline for d3rn1d_:

• d3rn1d_ first appeared in SCOPe 2.03
  
• d3rn1d_ appears in SCOPe 2.05
  
• d3rn1d_ appears in the current release, SCOPe 2.08