Lineage for d3rmzf_ (3rmz F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808785Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2808786Protein automated matches [232762] (1 species)
    not a true protein
  7. 2808787Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2808791Domain d3rmzf_: 3rmz F: [233462]
    Other proteins in same PDB: d3rmzc1, d3rmzc2, d3rmze_
    automated match to d2madh_
    complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4

Details for d3rmzf_

PDB Entry: 3rmz (more details), 1.72 Å

PDB Description: Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex
PDB Compounds: (F:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3rmzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rmzf_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

SCOPe Domain Coordinates for d3rmzf_:

Click to download the PDB-style file with coordinates for d3rmzf_.
(The format of our PDB-style files is described here.)

Timeline for d3rmzf_: