Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) |
Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
Protein automated matches [232762] (1 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
Domain d3rmzf_: 3rmz F: [233462] Other proteins in same PDB: d3rmzc1, d3rmzc2, d3rmze_ automated match to d2madh_ complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4 |
PDB Entry: 3rmz (more details), 1.72 Å
SCOPe Domain Sequences for d3rmzf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rmzf_ b.69.2.0 (F:) automated matches {Paracoccus denitrificans [TaxId: 318586]} qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv nqlghgpqvittadmg
Timeline for d3rmzf_:
View in 3D Domains from other chains: (mouse over for more information) d3rmzc1, d3rmzc2, d3rmzd_, d3rmze_ |