![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
![]() | Protein automated matches [232762] (1 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
![]() | Domain d3rmzd_: 3rmz D: [233461] Other proteins in same PDB: d3rmzc1, d3rmzc2, d3rmze_ automated match to d2madh_ complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4 |
PDB Entry: 3rmz (more details), 1.72 Å
SCOPe Domain Sequences for d3rmzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rmzd_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]} qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv nqlghgpqvittadmg
Timeline for d3rmzd_:
![]() Domains from other chains: (mouse over for more information) d3rmzc1, d3rmzc2, d3rmze_, d3rmzf_ |