SCOPe 2.06: Domain d3rmzd_: 3rmz D:

Lineage for d3rmzd_ (3rmz D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families)

5. Family b.69.2.0: automated matches [232760] (1 protein)
   not a true family

6. Protein automated matches [232762] (1 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)

8. Domain d3rmzd_: 3rmz D: [233461]
   Other proteins in same PDB: d3rmzc1, d3rmzc2, d3rmze_
   automated match to d2madh_
   complexed with act, ca, edo, hec, mes, na, p6g, peg, pg4

Details for d3rmzd_

PDB Entry: 3rmz, 1.72 Å

PDB Description: Crystal Structure of the W199F-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (D:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d3rmzd_:

Sequence; same for both SEQRES and ATOM records:

>d3rmzd_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
nqlghgpqvittadmg

Timeline for d3rmzd_:

• d3rmzd_ first appeared in SCOPe 2.03
  
• d3rmzd_ appears in SCOPe 2.05
  
• d3rmzd_ appears in SCOPe 2.07
  
• d3rmzd_ appears in the current release, SCOPe 2.08