Lineage for d3rloa2 (3rlo A:673-766)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384602Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 2384603Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
    Pfam PF02760
  6. 2384604Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)
  7. 2384605Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries)
    Uniprot Q16666 199-301! Uniprot Q16666 302-389
  8. 2384607Domain d3rloa2: 3rlo A:673-766 [233460]
    Other proteins in same PDB: d3rloa3
    automated match to d2oq0a1
    complexed with edo, fmt

Details for d3rloa2

PDB Entry: 3rlo (more details), 1.8 Å

PDB Description: Structural Basis of Cytosolic DNA Recognition by Innate Receptors
PDB Compounds: (A:) Gamma-interferon-inducible protein 16

SCOPe Domain Sequences for d3rloa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rloa2 b.40.16.1 (A:673-766) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
pkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdntgkmevvvhgrlttinceegdk
lkltcfelapksgntgelrsvihshikviktrkn

SCOPe Domain Coordinates for d3rloa2:

Click to download the PDB-style file with coordinates for d3rloa2.
(The format of our PDB-style files is described here.)

Timeline for d3rloa2: