![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.4: Animal virus proteins [49656] (16 proteins) |
![]() | Protein Murine polyomavirus coat protein vp1 [49657] (1 species) |
![]() | Species Murine polyoma virus, strain small-plaque 16 [49658] (5 PDB entries) |
![]() | Domain d1cn3a_: 1cn3 A: [23346] |
PDB Entry: 1cn3 (more details), 2.2 Å
SCOP Domain Sequences for d1cn3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cn3a_ b.10.1.4 (A:) Murine polyomavirus coat protein vp1 {Murine polyoma virus, strain small-plaque 16} mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspgnn tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk
Timeline for d1cn3a_:
![]() Domains from other chains: (mouse over for more information) d1cn3b_, d1cn3c_, d1cn3d_, d1cn3e_ |