Lineage for d3rlna2 (3rln A:673-763)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790436Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families) (S)
    duplication: tandem repeat of two OB-fold domains
  5. 1790437Family b.40.16.1: HIN-200/IF120x domain [159142] (1 protein)
    Pfam PF02760
  6. 1790438Protein Gamma-interferon-inducible protein Ifi-16 [159143] (1 species)
  7. 1790439Species Human (Homo sapiens) [TaxId:9606] [159144] (6 PDB entries)
    Uniprot Q16666 199-301! Uniprot Q16666 302-389
  8. 1790451Domain d3rlna2: 3rln A:673-763 [233459]
    automated match to d2oq0a1

Details for d3rlna2

PDB Entry: 3rln (more details), 2.25 Å

PDB Description: Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors
PDB Compounds: (A:) Gamma-interferon-inducible protein 16

SCOPe Domain Sequences for d3rlna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rlna2 b.40.16.1 (A:673-763) Gamma-interferon-inducible protein Ifi-16 {Human (Homo sapiens) [TaxId: 9606]}
pkinqlcsqtkgsfvngvfevhkknvrgeftyyeiqdatgkmevvvhgrlttinceegdk
lkltcfelapksgntgelrsvihshikvikt

SCOPe Domain Coordinates for d3rlna2:

Click to download the PDB-style file with coordinates for d3rlna2.
(The format of our PDB-style files is described here.)

Timeline for d3rlna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rlna1