Lineage for d3rjya_ (3rjy A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1341162Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1341163Protein automated matches [190075] (46 species)
    not a true protein
  7. 1341219Species Fervidobacterium nodosum [TaxId:381764] [233452] (2 PDB entries)
  8. 1341220Domain d3rjya_: 3rjy A: [233454]
    automated match to d3amdb_
    complexed with glc, po4

Details for d3rjya_

PDB Entry: 3rjy (more details), 2.2 Å

PDB Description: crystal structure of hyperthermophilic endo-beta-1,4-glucanase in complex with substrate
PDB Compounds: (A:) Endoglucanase FnCel5A

SCOPe Domain Sequences for d3rjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjya_ c.1.8.0 (A:) automated matches {Fervidobacterium nodosum [TaxId: 381764]}
msafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsahise
kypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqvaqaf
kdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyvrel
klvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvsewak
knnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtktwi
eplttsalgk

SCOPe Domain Coordinates for d3rjya_:

Click to download the PDB-style file with coordinates for d3rjya_.
(The format of our PDB-style files is described here.)

Timeline for d3rjya_: