SCOPe 2.07: Domain d3rjxa_: 3rjx A:

Lineage for d3rjxa_ (3rjx A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Fervidobacterium nodosum [TaxId:381764] [233452] (2 PDB entries)

8. Domain d3rjxa_: 3rjx A: [233453]
   automated match to d3amdb_

Details for d3rjxa_

PDB Entry: 3rjx, 2.4 Å

PDB Description: crystal structure of hyperthermophilic endo-beta-1,4-glucanase

PDB Compounds: (A:) Endoglucanase FnCel5A

SCOPe Domain Sequences for d3rjxa_:

Sequence; same for both SEQRES and ATOM records:

>d3rjxa_ c.1.8.0 (A:) automated matches {Fervidobacterium nodosum [TaxId: 381764]}
vdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsah
isekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqva
qafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyv
relklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvse
wakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtk
twieplttsalgk

Timeline for d3rjxa_:

• d3rjxa_ first appeared in SCOPe 2.03
  
• d3rjxa_ appears in SCOPe 2.06
  
• d3rjxa_ appears in the current release, SCOPe 2.08