Lineage for d3rjxa_ (3rjx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083935Species Fervidobacterium nodosum [TaxId:381764] [233452] (2 PDB entries)
  8. 2083937Domain d3rjxa_: 3rjx A: [233453]
    automated match to d3amdb_

Details for d3rjxa_

PDB Entry: 3rjx (more details), 2.4 Å

PDB Description: crystal structure of hyperthermophilic endo-beta-1,4-glucanase
PDB Compounds: (A:) Endoglucanase FnCel5A

SCOPe Domain Sequences for d3rjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjxa_ c.1.8.0 (A:) automated matches {Fervidobacterium nodosum [TaxId: 381764]}
vdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsah
isekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqva
qafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyv
relklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvse
wakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtk
twieplttsalgk

SCOPe Domain Coordinates for d3rjxa_:

Click to download the PDB-style file with coordinates for d3rjxa_.
(The format of our PDB-style files is described here.)

Timeline for d3rjxa_: