![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Marinobacter aquaeolei [TaxId:351348] [233449] (1 PDB entry) |
![]() | Domain d3rh9a_: 3rh9 A: [233451] automated match to d3k2wb_ |
PDB Entry: 3rh9 (more details), 2.63 Å
SCOPe Domain Sequences for d3rh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rh9a_ c.82.1.0 (A:) automated matches {Marinobacter aquaeolei [TaxId: 351348]} miespllenltgyiggrwkdsaggatfdvynpatgsviakvpsmpeedvvaaveagqsal rltnpwpietrrkwledirdglkenreeigrilcmehgkpwkeaqgevdyaagffdycak hisaldshtipekpkdctwtvhyrpvgvtglivpwnfpigmiakklsaalaagcpsvikp asetpltmiaffsvmdkldlpdgmvnlvmgkasvigkvlcehkdvpmlsftgstevgrkl ivdtaeqvkklalelggnapfivfddadleaaadnliankfrgggqtcvcanrifvhekv adafgqklaervnkmtvgdgmndgidigplinkqgfdkvkrhlqdaldkgaslvagkqpa elgdglffpptvvqgvdremccyqeetfgplvpmalfrteeevidagndtefglasyvft adaeraqrvaaglrfghvgwntgtgptpeapfggmkasgigreggleglfefveaqtvpr g
Timeline for d3rh9a_: