SCOPe 2.03: Domain d3rfza2: 3rfz A:159-279

Lineage for d3rfza2 (3rfz A:159-279)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (7 families)
Family b.2.3.2: Pilus subunits [49405] (9 proteins)
Protein automated matches [190569] (7 species)
not a true protein
Species Escherichia coli [TaxId:562] [188033] (4 PDB entries)
Domain d3rfza2: 3rfz A:159-279 [233448]
Other proteins in same PDB: d3rfzc1, d3rfzc2, d3rfzf1, d3rfzf2
automated match to d1ze3h1
complexed with so4

Details for d3rfza2

PDB Entry: 3rfz (more details), 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate

PDB Compounds: (A:) Type 1 fimbrial adhesin

SCOPe Domain Sequences for d3rfza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rfza2 b.2.3.2 (A:159-279) automated matches {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdyrgsvpipltvycaksqnlgyylsgthadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOPe Domain Coordinates for d3rfza2:

Click to download the PDB-style file with coordinates for d3rfza2.
(The format of our PDB-style files is described here.)

Timeline for d3rfza2: