Lineage for d3rf3a1 (3rf3 A:2-128)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700163Protein automated matches [226863] (2 species)
    not a true protein
  7. 2700171Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)
  8. 2700172Domain d3rf3a1: 3rf3 A:2-128 [233446]
    automated match to d1syqa1
    complexed with cac

Details for d3rf3a1

PDB Entry: 3rf3 (more details), 1.61 Å

PDB Description: Shigella IpaA-VBS3 in complex with human vinculin
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d3rf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rf3a1 a.24.9.1 (A:2-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlvrvgket
vqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsd
llltfde

SCOPe Domain Coordinates for d3rf3a1:

Click to download the PDB-style file with coordinates for d3rf3a1.
(The format of our PDB-style files is described here.)

Timeline for d3rf3a1: