Class a: All alpha proteins [46456] (286 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein automated matches [226863] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries) |
Domain d3rf3b2: 3rf3 B:129-258 [233445] automated match to d1rkea2 complexed with cac |
PDB Entry: 3rf3 (more details), 1.61 Å
SCOPe Domain Sequences for d3rf3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rf3b2 a.24.9.1 (B:129-258) automated matches {Human (Homo sapiens) [TaxId: 9606]} aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl qltswdedaw
Timeline for d3rf3b2: