SCOPe 2.05: Domain d3rf3b2: 3rf3 B:129-258

Lineage for d3rf3b2 (3rf3 B:129-258)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein automated matches [226863] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)

8. Domain d3rf3b2: 3rf3 B:129-258 [233445]
   automated match to d1rkea2
   complexed with cac

Details for d3rf3b2

PDB Entry: 3rf3, 1.61 Å

PDB Description: Shigella IpaA-VBS3 in complex with human vinculin

PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d3rf3b2:

Sequence; same for both SEQRES and ATOM records:

>d3rf3b2 a.24.9.1 (B:129-258) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqelthqehr
vmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaeineiirvl
qltswdedaw

Timeline for d3rf3b2:

• d3rf3b2 first appeared in SCOPe 2.03
  
• d3rf3b2 appears in SCOPe 2.04
  
• d3rf3b2 appears in SCOPe 2.06
  
• d3rf3b2 appears in the current release, SCOPe 2.08