| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries) |
| Domain d3reoc1: 3reo C:8-122 [233442] Other proteins in same PDB: d3reoa2, d3reob2, d3reoc2, d3reod2 automated match to d3tkyd1 complexed with eug, sah |
PDB Entry: 3reo (more details), 1.9 Å
SCOPe Domain Sequences for d3reoc1:
Sequence, based on SEQRES records: (download)
>d3reoc1 a.4.5.0 (C:8-122) automated matches {Clarkia breweri [TaxId: 36903]}
eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaa
qlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
>d3reoc1 a.4.5.0 (C:8-122) automated matches {Clarkia breweri [TaxId: 36903]}
eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvpgyispaeiaaql
pttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
Timeline for d3reoc1: