Lineage for d3reoc1 (3reo C:8-122)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694648Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 2694661Domain d3reoc1: 3reo C:8-122 [233442]
    Other proteins in same PDB: d3reoa2, d3reob2, d3reoc2, d3reod2
    automated match to d3tkyd1
    complexed with eug, sah

Details for d3reoc1

PDB Entry: 3reo (more details), 1.9 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (C:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3reoc1:

Sequence, based on SEQRES records: (download)

>d3reoc1 a.4.5.0 (C:8-122) automated matches {Clarkia breweri [TaxId: 36903]}
eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaa
qlpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records): (download)

>d3reoc1 a.4.5.0 (C:8-122) automated matches {Clarkia breweri [TaxId: 36903]}
eiqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvpgyispaeiaaql
pttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

SCOPe Domain Coordinates for d3reoc1:

Click to download the PDB-style file with coordinates for d3reoc1.
(The format of our PDB-style files is described here.)

Timeline for d3reoc1: