Lineage for d3rd8a_ (3rd8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010471Species Mycobacterium smegmatis [TaxId:246196] [233438] (1 PDB entry)
  8. 2010472Domain d3rd8a_: 3rd8 A: [233439]
    automated match to d3rrpa_

Details for d3rd8a_

PDB Entry: 3rd8 (more details), 2.2 Å

PDB Description: crystal structure of fumarate hydratase class ii mycobacterium smegmatis
PDB Compounds: (A:) fumarate hydratase class II

SCOPe Domain Sequences for d3rd8a_:

Sequence, based on SEQRES records: (download)

>d3rd8a_ a.127.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
eyriehdtmgevrvpkdalwraqtqravenfpisfrglertqiralgllkaacaqvnkdl
glldpekadaiiaaageiaegkhddqfpidvfqtgsgtssnmntneviasiaaangvtvh
pndhvnmsqssndtfptathiaateaavrhlipalevlhaslaakakqwrtvvksgrthl
mdavpvtlgqefggyarqieagiervkatlprlgelaiggtavgtglnapegfgakvvev
lvnetglaelrtavdsfeaqaardglveasgalrtiavsltkiandirwmgsgpltglae
iqlpdlqpgssimpgkvnpvlpeavtqvacqvvgndaaiafggasgafelnvyipmmarn
llesftllsnvsrlfaercidglvaneerlrelaesspsivtplnsaigyeeaakvakqa
laekktirqtvidrgligdklsleeldrrldvlamarvk

Sequence, based on observed residues (ATOM records): (download)

>d3rd8a_ a.127.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
eyriehdtmgevrvpkdalwraqtqravenfpisfrglertqiralgllkaacaqvnkdl
glldpekadaiiaaageiaegkhddqfpidvfqtgsgtssnmntneviasiaaangvtvh
pndhvnmsqssndtfptathiaateaavrhlipalevlhaslaakakqwrtvvksgrthl
mdavpvtlgqefggyarqieagiervkatlprlgelaiggtavgtglnapegfgakvvev
lvnetglaelrtavdsfeaqaardglveasgalrtiavsltkiandirwmgsgpltglae
iqlpdlqpgssimpgkvnpvlpeavtqvacqvvgndaaiafggasgafelnvyipmmarn
llesftllsnvsrlfaercidglvaneerlrelaesspsivtplnsaigyeeaakvakqa
laekktirqtvidrgliglsleeldrrldvlamarvk

SCOPe Domain Coordinates for d3rd8a_:

Click to download the PDB-style file with coordinates for d3rd8a_.
(The format of our PDB-style files is described here.)

Timeline for d3rd8a_: